MMP 2 Zymography control (Recombinant Protein)

  • Catalog number
    30 131 002
  • Price
    Please ask
  • Size
    250 µl/ 50 lanes
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.24.24
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Protein description
    MMP2 is a ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly- -Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.
  • Research area interests
    Diseases associated with MMP2 include Multicentric Osteolysis, Nodulosis, And Arthropathy and Multicentric Osteolysis Of Torg. Among its related pathways are Pathways in cancer and Integrin Pathway
  • Package form
    liquid
  • Tested applications
    Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Other names
    Matrix Metalloproteinase 2, Progelatinase A, a 72kDa Type IV Collagenase
  • Peptide sequence
    MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
  • Available target modification
    No
  • Expression system
    Insect Cell
  • Product Subtype
    full length
  • Active form
    Yes, after APMA activation
  • Tag
    untagged
  • Contents
    50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
  • Protein purity
    > 95 %
  • Molecular weight
    72 kDa
  • UniProt number
    P08253
  • Gene number
    4313
  • Abbreviation
    N/A
  • Full name
    N/A
  • Other desciption
    Human recombinant progelatinase A is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant. The full-length recombinant proenzyme consists of 631 amino acids.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Description
    Isotype or positive controls by peptides, antibodies and deactivated samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    MMP14, MMP24, MMP28, MMP17, MMP15, MMP25, MMP16
  • Short name
    MMP 2 Zymography control (Recombinant Protein)
  • Technique
    Recombinant, Control, controls, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Homo sapiens
  • Alternative name
    MMP 2 Zymography reference (Rec. Protein)
  • Alternative technique
    rec, controls
  • Tissue
    control
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 17
  • Synonyms gene name
    • matrix metalloproteinase 17 (membrane-inserted)
    • matrix metallopeptidase 17 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 16
  • Synonyms gene
  • Synonyms gene name
    • matrix metalloproteinase 16 (membrane-inserted)
    • chromosome 8 open reading frame 57
    • matrix metallopeptidase 16 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee