MMP 2 Progelatinase A Recombinant Protein

MMP 2 Progelatinase A Recombinant Protein is available 2 times from Biotez labs

  • Abbreviation
    MMP2
  • Expression system
    Insect Cell
  • Other names
    Matrix Metalloproteinase 2, Progelatinase A, a 72kDa Type IV Collagenase
  • Protein subtype
    EC 3.4.24.24
  • Protein description
    MMP2 is a ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly- -Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.
  • Product Subtype
    full length
  • Molecular weight
    72 kDa
  • Gene number
    4313
  • Package form
    liquid
  • Storage condition
    Store at -70°C
  • Tested applications
    Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Full name
    matrix metallopeptidase 2
  • Shipping conditions
    dry ice
  • Purification
    Mentioned in the data sheet
  • Research area interests
    Diseases associated with MMP2 include Multicentric Osteolysis, Nodulosis, And Arthropathy and Multicentric Osteolysis Of Torg. Among its related pathways are Pathways in cancer and Integrin Pathway
  • Other desciption
    MMP2 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.
  • Peptide sequence
    MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
  • Technical datasheet
    Contact us to receive the datasheet
  • Contents
    50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
  • Available target modification
    No
  • Protein purity
    > 95 %
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Tag
    untagged
  • UniProt number
    P08253
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Protein type
    Recombinant
  • Gene target
  • Short name
    MMP 2 (Progelatinase A) (Recombinant Protein)
  • Technique
    Recombinant
  • Alternative name
    MMP 2 (Progelatinase A) (recombinant Protein)
  • Alternative technique
    rec

30 100 602 | MMP 2 (Progelatinase A) (Recombinant Protein)size: 10 µg/ 50µl | 282.88 USD

Ajax processing

30 100 603 | MMP 2 (Progelatinase A) (Recombinant Protein)size: 200 µg/ 1 ml | 3978.73 USD

  • Catalog number
    30 100 603
  • Supplier
  • Price
    3978.73 USD
  • Size
    200 µg/ 1 ml
  • Active form?
    Yes,after APMA activation
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
0. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Simillar products
Supplier:ABM microrna
Price:1 514.01USD
Supplier:aviva
Price:521.48USD
Supplier:SFC
Price:0.00USD
Supplier:Trevigen
Price:477.20USD
Supplier:MBS Recombinant
Price:1 807.95USD
Supplier:SFC
Price:0.00USD
Supplier:MBS Recombinant
Price:1 509.09USD
Supplier:fitzgerald
Price:478.43USD
Supplier:trca
Price:552.23USD
Supplier:Pariselements
Price:505.49USD
Supplier:Abbkine
Price:344.37USD
Supplier:Gentaur Genprice
Price:122.99USD
Supplier:aviva
Price:521.48USD
Supplier:ABM microrna
Price:206.62USD
Supplier:MBS Polyclonals
Price:523.94USD
Supplier:MBS Polyclonals
Price:387.42USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
MMP 2 Progelatinase A Recombinant Protein - Gentaur.com
Contact
Chat with gentaur.com employee