MLLT3 Blocking Peptide

• Catalog number
  33R-2694
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  ERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  MLLT3  
• Gene symbol
  MLLT3
• Short name
  MLLT3 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of MLLT3 antibody, catalog no. 70R-8261
• Alternative technique
  control, peptides
• Alternative to gene target
  myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3, AF9 and YEATS3, MLLT3 and IDBG-53077 and ENSG00000171843 and 4300, protein binding, nuclei, Mllt3 and IDBG-161577 and ENSMUSG00000028496 and 70122, MLLT3 and IDBG-630240 and ENSBTAG00000014124 and 521962

Gene info

• Identity
  HGNC:7136
• Gene
  MLLT3
• Long gene name
  MLLT3 super elongation complex subunit
• Synonyms gene name
  • myeloid/lymphoid or mixed-lineage leukemia; translocated to, 3
• Synonyms
  • AF-9
  • AF9
  • YEATS3
• GenBank acession
  • L13744
• Locus
  9p21.3
• Discovery year
  1993-04-08
• Entrez gene record
  4300
• Pubmed identfication
  • 8506309
  • 8414510
• RefSeq identity
  • NM_004529
• Classification
  • MicroRNA protein coding host genes
  • Super elongation complex
  • YEATS domain containing
• VEGA ID
  OTTHUMG00000019650

Similar products