MLH1 antibody

• Catalog number
  70R-5690
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cancer
• Type of Immunogen
  MLH1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
• Raised in
  Rabbit
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLH1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  MLH1 Blocking Peptide, catalog no. 33R-6109, is also available for use as a blocking control in assays to test for specificity of this MLH1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against MLH1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  MLH1  
• Gene symbol
  MLH1
• Short name
  MLH1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal MLH1 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli), COCA2 and FCC2 and hMLH1 and HNPCC and HNPCC2, MLH1 and IDBG-24600 and ENSG00000076242 and 4292, structure-specific DNA binding, nuclei, Mlh1 and IDBG-202755 and ENSMUSG00000032498 and 17350, MLH1 and IDBG-644253 and ENSBTAG00000016758 and 533652

Gene info

• Identity
  HGNC:7127
• Gene
  MLH1
• Long gene name
  mutL homolog 1
• Synonyms gene
  • COCA2
• Synonyms gene name
  • mutL (E. coli) homolog 1 (colon cancer, nonpolyposis type 2)
  • mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli)
• Synonyms
  • HNPCC
  • FCC2
  • HNPCC2
• GenBank acession
  • U07418
• Locus
  3p22.2
• Discovery year
  1993-11-24
• Entrez gene record
  4292
• Pubmed identfication
  • 7903889
• RefSeq identity
  • NM_000249
• Classification
  • MutL homologs
• VEGA ID
  OTTHUMG00000130797
• Locus Specific Databases
  • Hereditary Non-Polyposis Colorectal Cancer, HNPCC
  • Global Variome shared LOVD
  • MLH1 database at LOVD-China
  • LOVD - Leiden Open Variation Database
  • LRG_216

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products