MGST1 Antibody
-
Catalog numberR31937
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenMGST1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the MGST1 antibody should be determined by the researcher.
-
Intented useThis MGST1 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP10620
-
PurityAntigen affinity
-
DescriptionMicrosomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.
-
ImmunogenAmino acids KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA of human MGST1 were used as the immunogen for the MGST1 antibody.
-
StorageAfter reconstitution, the MGST1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolMGST1, PTGES
-
Short nameAnti-MGST1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to MGST1
-
Alternative techniqueantibodies
-
Alternative to gene targetmicrosomal glutathione S-transferase 1, GST12 and MGST and MGST-I, MGST1 and IDBG-21764 and ENSG00000008394 and 4257, glutathione binding, nuclei, Mgst1 and IDBG-195593 and ENSMUSG00000008540 and 56615, MGST1 and IDBG-639137 and ENSBTAG00000008541 and 493719
-
Gene info
-
Identity
-
Gene
-
Long gene namemicrosomal glutathione S-transferase 1
-
Synonyms gene
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1989-05-24
-
Entrez gene record
-
RefSeq identity
-
Classification
- Microsomal glutathione S-transferases
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameprostaglandin E synthase
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-05-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data