-
Target antigen
MCM8
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the MCM8 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The MCM8 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
-
Related articles
1. "Entrez Gene: MCM8 MCM8 minichromosome maintenance deficient 8 (S. cerevisiae)". 2. Gozuacik D, Chami M, Lagorce D, Faivre J, Murakami Y, Poch O, Biermann E, Knippers R, Brechot C, Paterlini-Brechot P (Jan 2003). "Identification and functional characterization of a new member of the human Mcm protein family: hMcm8". Nucleic Acids Res 31 (2): 570–9.
-
Gene Name
MCM8
-
Protein Name
DNA helicase MCM8
-
Gene Full Name
minichromosome maintenance 8 homologous recombination repair factor
-
Synonyms
C20orf154 antibody|dJ967N21.5 antibody|DNA helicase MCM8 antibody|DNA replication licensing factor MCM8 antibody|MCM8 antibody| MCM8_HUMAN antibody|MGC119522 antibody|MGC119523 antibody|MGC12866 antibody|MGC4816 antibody|Minichromosome maintenance 8 antibody| Minichromosome maintenance complex component 8 antibody|REC antibody
-
Uniprot ID
Q9UJA3
-
Entrez GeneID
84515
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
