-
Target antigen
MC3 Receptor
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MC3 Receptor (91-121aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the MC3 Receptor Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The MC3 Receptor Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
-
Related articles
1. "Entrez Gene: MC3R melanocortin 3 receptor". 2. Gantz I, Konda Y, Tashiro T, Shimoto Y, Miwa H, Munzert G, Watson SJ, DelValle J, Yamada T (Apr 1993). "Molecular cloning of a novel melanocortin receptor". The Journal of Biological Chemistry. 268 (11): 8246–50. 3. Konda Y, Gantz I, DelValle J, Shimoto Y, Miwa H, Yamada T (May 1994). "Interaction of dual intracellular signaling pathways activated by the melanocortin-3 receptor". The Journal of Biological Chemistry. 269 (18): 13162–6.
-
Gene Name
MC3R
-
Protein Name
Melanocortin receptor 3
-
Gene Full Name
melanocortin 3 receptor
-
Synonyms
BMIQ9 | MC3 | MC3 R | MC3-R | Mc3r | OB20 | OQTL | P41968
-
Uniprot ID
P41968
-
Entrez GeneID
4159
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps
