Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)

  • Catalog number
    P285260
  • Price
    Please ask
  • Size
    1 mg
  • Chemical available in other sizes
    Please inquire size and price
  • Stock availability
    Available in 2-3 weeks
  • Cas number
    This product doesn't have CAS Number
  • Chemical s molecular weight
    10765.76
  • Chemical s main applications
    No Data Available
  • Other name
    98-MER;
  • Chemical s formula
    C477H815N149O125S4
  • Physical properties
    No Data Available
  • Melting temperature
    No Data Available
  • Boiling temperature
    No Data Available
  • Chemical s soluble in
    No Data Available
  • Stability conditions
    No Data Available
  • Storage
    No Data Available
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
MeSH Data
  • Name
  • Concept
    Scope note: A multistage process that includes cloning, physical mapping, subcloning, determination of the DNA SEQUENCE, and information analysis.
  • Tree numbers
    • E05.393.760.700
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee