KCNQ1 Antibody
-
Catalog numberA00310-1
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenKCNQ1
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the KCNQ1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe KCNQ1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundKv7.1 (KvLQT1) is a potassium channel protein whose primary subunit in humans is encoded by the KCNQ1 gene. This protein can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in this gene are associated with hereditary long QT syndrome 1 (also known as Romano-Ward syndrome), Jervell and Lange-Nielsen syndrome, and familial atrial fibrillation. This gene exhibits tissue-specific imprinting, with preferential expression from the maternal allele in some tissues, and biallelic expression in others. And this gene is located in a region of chromosome 11 amongst other imprinted genes that are associated with Beckwith-Wiedemann syndrome (BWS), and itself has been shown to be disrupted by chromosomal rearrangements in patients with BWS. Alternatively spliced transcript variants have been found for this gene.
-
Related articles1. "Entrez Gene: KCNQ1 potassium voltage-gated channel, KQT-like subfamily, member 1". 2. Jespersen T, Grunnet M, Olesen SP (2005). "The KCNQ1 potassium channel: from gene to physiological function". Physiology (Bethesda). 20 (6): 408–16. 3. Torekov SS, Iepsen E, Christiansen M, Linneberg A, Pedersen O, Holst JJ, Kanters JK, Hansen T (2014). "KCNQ1 Long QT syndrome patients have hyperinsulinemia and symptomatic hypoglycemia.)". Diabetes. 63 (4): 1315–25.
-
Gene NameKCNQ1
-
Protein NamePotassium voltage-gated channel subfamily KQT member 1
-
Gene Full Namepotassium voltage-gated channel subfamily Q member 1
-
SynonymsATFB1 | ATFB3 | JLNS1 | KCNA8 | KCNA9 | KCNQ1 | Kv1.9 | Kv7.1 | KVLQT1 | LQT | LQT1 | RWS | SQT2 | WRS | P51787
-
Uniprot IDP51787
-
Entrez GeneID3784
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolKCNQ1-AS1, KCNQ1OT1, KCNQ1
-
Short nameKCNQ1 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameKCNQ1 (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameKCNQ1 antisense RNA 1
-
Synonyms gene name
- KCNQ1 antisense RNA 1 (non-protein coding)
-
GenBank acession
-
Locus
-
Discovery year2011-08-19
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameKCNQ1 opposite strand/antisense transcript 1
-
Synonyms gene name
- KCNQ1 opposite strand/antisense transcript 1 (non-protein coding)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1999-08-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Long non-coding RNAs with non-systematic symbols
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namepotassium voltage-gated channel subfamily Q member 1
-
Synonyms gene
-
Synonyms gene name
- potassium voltage-gated channel, KQT-like subfamily, member 1
- potassium channel, voltage gated KQT-like subfamily Q, member 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1997-02-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Potassium voltage-gated channels
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data