-
Target antigen
KChIP2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the KChIP2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The KChIP2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
-
Related articles
1. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ (Feb 2000). "Modulation of A-type potassium channels by a family of calcium sensors". Nature 403(6769): 553–6. 2. Burgoyne RD (2007). "Neuronal calcium sensor proteins: generating diversity in neuronal Ca2+ signalling". Nat. Rev. Neurosci. 8 (3): 182–93.
-
Gene Name
KCNIP2
-
Protein Name
Kv channel-interacting protein 2
-
Gene Full Name
Kv channel interacting protein 2
-
Synonyms
A type potassium channel modulatory protein 2 antibody|A-type potassium channel modulatory protein 2 antibody|Cardiac voltage gated potassium channel modulatory subunit antibody|Cardiac voltage-gated potassium channel modulatory subunit antibody|DKFZp566L1246 antibody|KChIP 2 antibody|KChIP2 antibody|KCIP2_HUMAN antibody|KCNIP 2 antibody|Kcnip2 antibody|Kv channel interacting protein 2 antibody|Kv channel-interacting protein 2 antibody|MGC17241 antibody|Potassium channel interacting protein 2 antibody|Potassium channel-interacting protein 2 antibody
-
Uniprot ID
Q9NS61
-
Entrez GeneID
30819
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
