Integrin beta 3 Antibody / ITGB3 / CD61

  • Catalog number
    R31891
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    Integrin beta 3 / ITGB3 / CD61
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
  • Notes
    Optimal dilution of the CD61 antibody should be determined by the researcher.
  • Intented use
    This CD61 antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P05106
  • Purity
    Antigen affinity
  • Description
    Integrin beta 3, also called GP3A, GPIIIa, and CD61, is a protein that in humans is encoded by the ITGB3 gene. It is a cluster of differentiation found on thrombocytes. The 3-prime exon is larger than 1,700 nucleotides and contains the 3-prime untranslated region. The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits. Additionally, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen. Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, it could not be activated via the 'inside-out' signaling pathways.
  • Immunogen
    Amino acids FAKFEEERARAKWDTANNPLYKEATSTFTNITYR of human CD61 were used as the immunogen for the CD61 antibody.
  • Storage
    After reconstitution, the CD61 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Cell surface, cytoplasmic
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    Integrin   beta   ITGB3   CD61  
  • Gene symbol
    ITGB3
  • Short name
    Anti-Integrin beta 3 / ITGB3 / CD61
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to Integrin beta 3 / ITGB3 / CD61
  • Alternative technique
    antibodies
  • Alternative to gene target
    integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), BDPLT16 and BDPLT2 and CD61 and GP3A and GPIIIa and GT, ITGB3 and IDBG-547297 and ENSG00000259207 and 3690, cell adhesion molecule binding, nuclei
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee