IL7R Blocking Peptide

IL7R Blocking Peptide is available 2 times from Fitzgerald labs

33R-2725 | IL7R Blocking Peptidesize: 100 µg | 239.21 USD

Ajax processing

33R-2725 | IL7R Blocking Peptidesize: 100 ug | 318.95 USD

Ajax processing
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Signal Transduction
  • Residues
    ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP
  • Type of protein
    Synthetic
  • Form & Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Signal Transduction
  • Tag/Conjugate
    ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP
  • Type1
    Synthetic
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Short name
    IL7R Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide
  • Alternative name
    interleukin 7 receptor inhibiting short protein sequence
  • Alternative technique
    control
  • Alternative to gene target
    interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554
Simillar products
Supplier:BT-Laboratory
Price:228.96USD
Supplier:ABM microrna
Price:191.37USD
Supplier:acr
Price:395.27USD
Supplier:abbex
Price:1 202.89USD
Supplier:MyBioSource
Price:378.18USD
Supplier:abbex
Price:288.19USD
Supplier:trca
Price:379.32USD
Supplier:EnoGene
Price:427.16USD
Supplier:Biomatik
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
IL7R Blocking Peptide - Gentaur.com
Contact
Chat with gentaur.com employee