IL7R alpha Antibody
-
Catalog numberPB9948
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenIL7R alpha
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the IL7R alpha Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe IL7R alpha Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundThe interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
-
Related articles1. "Entrez Gene: IL7R interleukin 7 receptor". 2. Kroemer RT, Richards WG (December 1996). "Homology modeling study of the human interleukin-7 receptor complex".Protein Eng. 9 (12): 1135–42. 3. O'Doherty C, Alloza I, Rooney M, Vandenbroeck K (November 2009). "IL7RA polymorphisms and chronic inflammatory arthropathies". Tissue Antigens 74 (5): 429–31.
-
Gene NameIL7R
-
Protein NameInterleukin-7 receptor subunit alpha
-
Gene Full Nameinterleukin 7 receptor
-
SynonymsCD 127 | CD127 | CD127 antigen | IL 7R alpha | IL-7R-alpha | IL 7R | IL7R | IL-7RA | IL7RA | IL7Ralpha | ILRA | Interleukin 7 receptor | P16871
-
Uniprot IDP16871
-
Entrez GeneID3575
-
DescriptionThe IL7R alpha Antibody is a α- or alpha protein sometimes glycoprotein present in blood.
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolIL7R
-
Short nameIL7R alpha Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameinterleukin 7 receptor a (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetinterleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin 7 receptor
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1991-08-07
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Interleukin receptors
- Fibronectin type III domain containing
- CD molecules
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data