IL7R alpha Antibody

IL7R alpha Antibody is available 1 time from Boster labs

  • Target antigen
    IL7R alpha
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species:
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the IL7R alpha Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The IL7R alpha Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
  • Related articles
    1. "Entrez Gene: IL7R interleukin 7 receptor". 2. Kroemer RT, Richards WG (December 1996). "Homology modeling study of the human interleukin-7 receptor complex".Protein Eng. 9 (12): 1135–42. 3. O'Doherty C, Alloza I, Rooney M, Vandenbroeck K (November 2009). "IL7RA polymorphisms and chronic inflammatory arthropathies". Tissue Antigens 74 (5): 429–31.
  • Gene Name
    IL7R
  • Protein Name
    Interleukin-7 receptor subunit alpha
  • Gene Full Name
    interleukin 7 receptor
  • Synonyms
    CD 127 | CD127 | CD127 antigen | IL 7R alpha | IL-7R-alpha | IL 7R | IL7R | IL-7RA | IL7RA | IL7Ralpha | ILRA | Interleukin 7 receptor | P16871
  • Uniprot ID
    P16871
  • Entrez GeneID
    3575
  • Description
    The IL7R alpha Antibody is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    IL7R alpha Antibody
  • Technique
    Antibody
  • Alternative name
    interleukin 7 receptor a (Antibody to)
  • Alternative technique
    antibodies
  • Alternative to gene target
    interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, this GO :0000018 and regulation of DNA recombination and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0001915 and negative regulation of T cell mediated cytotoxicity and biological process this GO :0002377 and immunoglobulin production and biological process this GO :0003823 and antigen binding and molecular function this GO :0004896 and cytokine receptor activity and molecular function this GO :0004917 and interleukin-7 receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008361 and regulation of cell size and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016049 and cell growth and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0038111 and interleukin-7-mediated signaling pathway and biological process this GO :0042100 and B cell proliferation and biological process this GO :0048535 and lymph node development and biological process this GO :0048872 and homeostasis of number of cells and biological process, protein binding, this GO :0003823: antigen binding and also this GO :0004896: cytokine receptor activity and also this GO :0004917: interleukin-7 receptor activity and also this GO :0005515: protein binding, this GO :0003823: antigen binding, this GO :0004896: cytokine receptor activity, this GO :0004917: interleukin-7 receptor activity, this GO :0005515: protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554

PB9948 | IL7R alpha Antibodysize: 0,1 mg | 460.36 USD

Ajax processing
Simillar products
Supplier:Ape
Price:1 234.72USD
Supplier:nordc
Price:615.45USD
Supplier:ABM microrna
Price:1 515.24USD
Supplier:Biovision
Price:188.33USD
Supplier:cclone
Price:917.02USD
Supplier:SFC
Price:0.00USD
Supplier:SAB ELISA KIT
Price:702.84USD
Supplier:BioGenEx Antibodies
Price:471.43USD
Supplier:genways bulk
Price:0.00USD
Supplier:StressMarq
Price:600.68USD
Supplier:ABM microrna
Price:142.78USD
Supplier:abbex
Price:563.75USD
Supplier:Research sys
Price:177.25USD
Supplier:acr
Price:347.11USD
Supplier:abbex
Price:731.15USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
IL7R alpha Antibody - Gentaur.com
Contact
Chat with gentaur.com employee