IL10R Alpha Blocking Peptide

IL10R Alpha Blocking Peptide is available 2 times from Fitzgerald labs

  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Cytokines & Growth Factors
  • Tag/Conjugate
    GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
  • Type1
    Synthetic
  • Form & Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Cytokines & Growth Factors
  • Residues
    GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
  • Type of protein
    Synthetic
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Description
    The IL10R Alpha Blocking Peptide is a α- or alpha protein sometimes glycoprotein present in blood.Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Gene target
  • Short name
    IL10R Alpha Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide
  • Alternative name
    IL10R a inhibiting short protein sequence
  • Alternative technique
    control

33R-3595 | IL10R Alpha Blocking Peptidesize: 100 ug | 326.9 USD

Ajax processing

33R-3595 | IL10R Alpha Blocking Peptidesize: 100 µg | 245.18 USD

Ajax processing
Simillar products
Supplier:Biochempeg
Price:618.78USD
Supplier:MBS Recombinant
Price:2 510.13USD
Supplier:sakura
Price:2 190.44USD
Supplier:Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price:408.80USD
Supplier:acr
Price:380.61USD
Supplier:MyBioSource
Price:0.00USD
Supplier:Cusabio
Price:247.51USD
Supplier:trca
Price:134.26USD
Supplier:MBS Polyclonals
Price:581.42USD
Supplier:Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price:388.49USD
Supplier:aviva
Price:495.02USD
Supplier:MBS Recombinant
Price:1 478.06USD
Supplier:acr
Price:566.24USD
Supplier:bioma
Price:781.06USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
IL10R Alpha Blocking Peptide - Gentaur.com
Contact
Chat with gentaur.com employee