IL10R Alpha antibody

IL10R Alpha antibody is available 2 times from Fitzgerald labs

70R-1865 | IL10R Alpha antibodysize: 100 µg | 443.11 USD

Ajax processing

70R-1865 | IL10R Alpha antibodysize: 100 ug | 484.12 USD

Ajax processing
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cytokines & Growth Factors
  • Type of Immunogen
    IL10R Alpha antibodies were raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
  • Raised in
  • Specificity
    IL10R Alpha antibody was raised against the N terminal of IL10RA
  • Cross Reactivity
  • Method of Purification
    Total IgG Protein A purified
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IL10RA antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
  • Usage Recommendations
    WB: 5 ug/ml
  • Assay Information
    IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody
  • Additional Information
    This is a rabbit polyclonal antibody against IL10RA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at
  • Applications
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cytokines & Growth Factors
  • Immunogen
    IL10R Alpha antibody was raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
  • Shipping Info
    Blue Ice
  • Description
    The IL10R Alpha antibody is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
  • Gene target
  • Short name
    IL10R Alpha antibody
  • Technique
  • Alternative name
    IL10R a (Antibody to)
  • Alternative technique
Simillar products
Supplier:abm Adinovirus
Supplier:MBS Recombinant
Price:2 687.14USD
Supplier:BlueGen ELISAs
Supplier:ABM microrna
Price:1 483.11USD
IL10R Alpha antibody -
Chat with employee