-
Stock availability
In Stock
-
Scientific context
Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson’s disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
-
Protein target
Alpha Synuclein
-
Protein reactivity
Human
-
Certificate of analysis
Certified >95% pure using SDS-PAGE analysis.
-
Protein description
Active Human Recombinant Alpha Synuclein Protein Monomer
-
Other name
Active Alpha synuclein monomer, Active Alpha-synuclein monomer, Active Alpha synuclein protein monomer, Active Alpha synuclein monomer, Active Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Active Alpha synuclein monomers, SYN protein, Parkison disease familial 1 Protein
-
Primary research area
Neuroscience, Neurodegeneration, Parkinson's Disease, Alzheimer's Disease
-
Category
Protein
-
Brand name
none
-
Origin
Recombinant
-
NCBI number
NP_000336.1
-
Gene number
6622
-
Protein number
P37840
-
Verified applications
WB, SDS-PAGE, In vivo assay, In vitro assay
-
Relevant bio activity
100 µM alpha synuclein protein monomer (SPR-321) seeded with 10 nM alpha synuclein protein aggregate (SPR-322) in 25 µM Thioflavin T (PBS pH 7.4, 100 µl reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450 nm and emission at 485 nm on a Molecular Devices Gemini XPS microplate reader.
-
Protein expression model
E. coli
-
Protein charasterics
Full Length
-
Peptide sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
-
Protein purification
Ion-exchange Purified
-
Purity pourcentage
>95% High purity
-
Recommended buffer for storage
PBS
-
Protein concentration
Lot/batch specific. See included datasheet.
-
Protein specificity
~14.46 kDa
-
Protein tag
No tag
-
Storage recommendations
-80°C
-
Shipping recommendations
Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
-
Supplementary useful information
Please see included datasheet or contact us
-
Protein cell localization
Cytoplasm, Membrane, Nucleus
-
Bibliography
1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van’kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.
-
Release date
8-Nov-2016
-
PubMed number
Not added. Please refer to PubMed
-
Tested applications
to be tested
-
Tested species reactivity
to be tested
-
Representative figure
-
Representative figure legend
Active alpha synuclein aggregate (SPR-322) seeds the formation of new alpha Synuclein aggregates from the pool of active alpha Synuclein monomers (SPR-321). Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha Synuclein aggregates. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to alpha Synuclein protein aggregation) over time when 10 nM of active alpha Synuclein aggregate (SPR-322) is combined with 100 µM of active alpha Synuclein monomer (SPR-321), as compared to when 100 µM of control alpha Synuclein monomer (SPR-316) is combined with 10 nM of active alpha Synuclein aggregate (SPR-322). Thioflavin T ex = 450 nm, em = 485 nm. | SDS-PAGE of ~14 kDa Active Human Recombinant Alpha Synuclein Protein Monomer (SPR-321). Lane 1: Molecular Weight Ladder (MW). Lane 2: BSA (5 µg). Lane 3: BSA (2.5 µg). Lane 4: Active Alpha Synuclein Protein Monomer (5 µg) (SPR-321). Lane 5: Active Alpha Synuclein Protein Monomer (2.5 µg) (SPR-321). Active alpha Synuclein monomers (SPR-321) form new alpha Synuclein aggregates through the seeding activity of active alpha synuclein aggregates (SPR-322) as shown by increased fluorescence intensity by Thioflavin T over time. | SDS-Page of Active Human Recombinant Alpha Synuclein Protein Monomer (SPR-321)
-
Warnings
Non-hazardous materials
-
Protein origin
Canada
-
Total weight kg
1.4
-
Net weight g
0.1
-
-
Description
The Recombinant Alpha Synuclein Protein is a α- or alpha protein sometimes glycoprotein present in blood.
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
