Bax Antibody

  • Catalog number
    A00183
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Bax
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Bax Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Bax Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
  • Related articles
    1. Apte, S. S.; Mattei, M.-G.; Olsen, B. R. : Mapping of human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX-delta. Genomics 26: 592-594, 1995. 2. Guo, B.; Zhai, D.; Cabezas, E.; Welsh, K.; Nouraini, S.; Satterthwait, A. C.; Reed, J. C. : Humanin peptide suppresses apoptosis by interfering with Bax activation. Nature 423: 456-461, 2003. 3. Oltvai, Z. N.; Milliman, C. L.; Korsmeyer, S. J. : Bcl-2 heterodimers in vivo with a conserved homolog, Bax, that accelerates programmed cell death. Cell 74: 609-619, 1993. 4. Takeuchi, O.; Fisher, J.; Suh, H.; Harada, H.; Malynn, B. A.; Korsmeyer, S. J. : Essential role of BAX,BAK in B cell homeostasis and prevention of autoimmune disease. Proc. Nat. Acad. Sci. 102: 11272-11277, 2005.
  • Gene Name
    BAX
  • Protein Name
    Apoptosis regulator BAX
  • Gene Full Name
    BCL2-associated X protein
  • Synonyms
    Apoptosis regulator BAX | BAXA | Bcl2-L-4 | BCL2L4 | Bcl-2-like protein 4 | Q07812
  • Uniprot ID
    Q07812
  • Entrez GeneID
    581
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    Bax  
  • Gene symbol
    TMBIM7P, TMBIM6, TMBIM1
  • Short name
    Bax Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    BCL2-associated X protein (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    BCL2-associated X protein, BCL2L4, BAX and IDBG-61459 and ENSG00000087088 and 581, BH3 domain binding, nuclei, Bax and IDBG-183241 and ENSMUSG00000003873 and 12028, BAX and IDBG-640344 and ENSBTAG00000013340 and 100850136,280730
Gene info
  • Identity
  • Gene
  • Long gene name
    transmembrane BAX inhibitor motif containing 7, pseudogene
  • Locus
  • Discovery year
    2013-10-09
  • Entrez gene record
  • Classification
    • Transmembrane BAX inhibitor motif containing
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee