HSPB1 Blocking Peptide

• Catalog number
  33R-8622
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Protein Modification & Stress Response
• Tag Conjugate
  SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  HSPB1  
• Gene symbol
  HSPB1
• Short name
  HSPB1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  heat shock 27kDa protein 1 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  heat shock 27kDa protein 1, CMT2F and HEL-S-102 and HMN2B and HS.76067 and Hsp25 and HSP27 and HSP28 and SRP27, HSPB1 and IDBG-23058 and ENSG00000106211 and 3315, poly(A) RNA binding, nuclei, Hspb1 and IDBG-204151 and ENSMUSG00000004951 and 15507, HSPB1 and IDBG-640144 and ENSBTAG00000011969 and 516099

Gene info

• Identity
  HGNC:5246
• Gene
  HSPB1
• Long gene name
  heat shock protein family B (small) member 1
• Synonyms gene name
  • heat shock 27kD protein 1
  • heat shock 27kDa protein 1
• Synonyms
  • HSP27
  • HSP28
  • Hs.76067
  • Hsp25
  • CMT2F
• GenBank acession
  • X54079
• Locus
  7q11.23
• Discovery year
  1991-07-09
• Entrez gene record
  3315
• Pubmed identfication
  • 2243808
  • 9344682
• Classification
  • Small heat shock proteins
• VEGA ID
  OTTHUMG00000023228
• Locus Specific Databases
  • Inherited Peripheral Neuropathies Mutation Database
  • LRG_248

Similar products