HMGB1 Antibody

• Catalog number
  A00066-1
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  HMGB1
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the HMGB1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The HMGB1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
• Related articles
  1. Ferrari S, Finelli P, Rocchi M, Bianchi ME (July 1996). "The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13". Genomics. 35 (2): 367–71. 2. Klune JR, Dhupar R, Cardinal J, Billiar TR, Tsung A (2008)."HMGB1: endogenous danger signaling". Mol. Med. 14 (7-8): 476–84. 3. Yang H, Hreggvidsdottir HS, Palmblad K, Wang H, Ochani M, Li J, Lu B, Chavan S, Rosas-Ballina M, Al-Abed Y, Akira S, Bierhaus A, Erlandsson-Harris H, Andersson U, Tracey KJ (June 2010). "A critical cysteine is required for HMGB1 binding to Toll-like receptor 4 and activation of macrophage cytokine release". Proc. Natl. Acad. Sci. U.S.A. 107 (26): 11942–7.
• Gene Name
  HMGB1
• Protein Name
  High mobility group protein B1
• Gene Full Name
  high mobility group box 1
• Synonyms
  Amphoterin | HMG-1 | HMG1 | HMG3 | HMGB 1 | HMGB1 | SBP 1 | P09429
• Uniprot ID
  P09429
• Entrez GeneID
  3146
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  HMGB1  
• Gene symbol
  HMGB1
• Short name
  HMGB1 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  high mobility group box 1 (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  high mobility group box 1, HMG1 and HMG3 and SBP-1, HMGB1 and IDBG-21100 and ENSG00000189403 and 3146, DNA binding, nuclei, Hmgb1 and IDBG-209311 and ENSMUSG00000066551 and 100862258,102642363,15289,619937, HMGB1 and IDBG-630533 and ENSBTAG00000018103 and 282691

Gene info

• Identity
  HGNC:4983
• Gene
  HMGB1
• Long gene name
  high mobility group box 1
• Synonyms gene
  • HMG1
• Synonyms gene name
  • high-mobility group (nonhistone chromosomal) protein 1
  • high-mobility group box 1
• Synonyms
  • HMG3
  • SBP-1
  • DKFZp686A04236
• Synonyms name
  • Sulfoglucuronyl carbohydrate binding protein
  • Amphoterin
  • high mobility group protein 1
• GenBank acession
  • D63874
• Locus
  13q12.3
• Discovery year
  1993-12-13
• Entrez gene record
  3146
• Pubmed identfication
  • 8661151
  • 11279268
• RefSeq identity
  • NM_002128
• Classification
  • Canonical high mobility group
• VEGA ID
  OTTHUMG00000016670

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products