Recombinant Human Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)

  • Catalog number
    C383-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Tryptase epsilon is produced by our Mammalian expression system and the target gene encoding Ala33-Ser317 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH
  • Estimated molecular weight
    31,56 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM HAc-NaAc, 150mM NaCl, 10% Glycerol, pH 4.5.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9GZN4
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Additional description
    Serine protease, D- or L-serine arginine rich enzyme of serine threonine kinase with serine that is encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC is an ɑ-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group (which is in the protonated −NH+ 3 form under biological conditions), a carboxyl group. It is non-essential in humans, meaning the body can synthesize it.
  • Gene target
  • Gene symbol
    PRSS22, PRSS12, KLK6, MIR1302-4, PIRC18, PIRC16, SNORD114-4, IGKV2OR2-4
  • Short name
    Recombinant Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human Tryptase epsilon/BSSP-4(C-6His)
  • Alternative technique
    rec
  • Tissue
    brain
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 18
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 16
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 2/OR2-4 (pseudogene)
  • Synonyms gene name
    • immunoglobulin kappa variable 2/OR2-4
    • immunoglobulin kappa variable 2/OR2-4 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee