GST-Δ/GSTD2, Active Recombinant (Bombyx mori (Silk moth))

  • Catalog number
    7840-100
  • Price
    Please ask
  • Size
    100 ug
  • Synonyms
    Glutathione S-Transferase Delta, GSTd2
  • Alternative_names
    Glutathione S-Transferase Delta, GSTd2
  • Description
    ≥98% Pure Bombyx mori recombinant GST-Δ/GSTD2, that plays an important role in detoxification.
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥95%
  • Assay
    SDS-PAGE
  • Endotoxin Level
    < 1.0 EU per 1 ug of protein (determined by LAL method).
  • Activity Specifications test method
    ≥ 20 U/mg as determined with BioVision’s GST colorimetric activity assay kit, Cat # K263-100.
  • Biological activity
    ≥ 20 U/mg as determined with BioVision’s GST colorimetric activity assay kit, Cat # K263-100.
  • Results
    ≥ 20 U/mg as determined with BioVision’s GST colorimetric activity assay kit, Cat # K263-100.
  • Unit Definition
    One unit of the recombinant GST-Δ is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
  • Molecular Weight
    26.4 kDa (236 aa, 1-216 aa + His Tag)
  • Storage Temp
    -20°C
  • Shipping
    gel pack
  • Shelf Life
    12 months
  • Concentration
    2.0 mg/ml
  • Appearance
    Liquid
  • Physical form description
    2.0 mg/ml solution in 30% glycerol without additives.
  • Background Information
    Glutathione S-transferase Δ is an enzyme in Bombyx mori (Silk moth) encoded by the GSTd2 gene. GSTs are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into nine classes: alpha, delta, kappa, mu, omega, pi, theta, zeta and microsomal. GSTs play a role in susceptibility to cancer, and other diseases.
  • Amino acid sequence
    MGSSHHHHHHSSGLVPRGSH MTIDLYYVPG SAPCRAVLLT AKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTLVDDG LSIWESRAIITYLVNKYAKGSSLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGAPADKAKNEKVQ EALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDIDFKKYAN VKRWYETVKSTAPGYQEANEKGLEAFKGLV NSMLKK
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    GST-Δ/GSTD2   Active   Bombyx   mori   Silk   moth  
  • Gene symbol
    MGST3
  • Short name
    GST-Δ/GSTD2, Active Recombinant (Bombyx mori (Silk moth))
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    GST-Δ/GSTD2, functionnal Rec. (Bombyx mori (Silk moth))
  • Alternative technique
    rec
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee