-
Target antigen
FUT1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
-
Product configuration
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the FUT1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The FUT1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
-
Related articles
1. "Entrez Gene: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)". 2. Ball SP, Tongue N, Gibaud A et al. (1992). "The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9". Ann. Hum. Genet. 55 (Pt 3): 225–33. 3. Yip SP, Chee KY, Chan PY et al. (2003). "Molecular genetic analysis of para-Bombay phenotypes in Chinese: a novel non-functional FUT1 allele is identified". Vox Sang. 83 (3): 258–62.
-
Gene Name
FUT1
-
Protein Name
Galactoside 2-alpha-L-fucosyltransferase 1
-
Gene Full Name
fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
-
Synonyms
2)FT 1 antibody|2-alpha-L-fucosyltransferase antibody|Alpha (1 2) fucosyltransferase antibody|Alpha(1 2)FT 1 antibody|Alpha(1 antibody|Blood group H alpha 2-fucosyltransferase antibody|fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) antibody| Fucosyltransferase 1 antibody|FUT1 antibody|FUT1_HUMAN antibody|Galactoside 2 alpha L fucosyltransferase antibody|Galactoside 2-alpha-L-fucosyltransferase 1 antibody|GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1 antibody|H antibody|HH antibody| HSC antibody|Para Bombay phenotype antibody
-
Uniprot ID
P19526
-
Entrez GeneID
2523
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
