-
Target antigen
GRK3
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the GRK3 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The GRK3 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
-
Related articles
1. Benovic, J. L., Onorato, J. J., Arriza, J. L., Stone, W. C., Lohse, M., Jenkins, N. A., Gilbert, D. J., Copeland, N. G., Caron, M. G., Lefkowitz, R. J. Cloning, expression, and chromosomal localization of beta-adrenergic receptor kinase 2: a new member of the receptor kinase family. J. Biol. Chem. 266: 14939-14946, 1991. 2. Calabrese G, Sallese M, Stornaiuolo A, Stuppia L, Palka G, De Blasi A (Feb 1995). "Chromosome mapping of the human arrestin (SAG), beta-arrestin 2 (ARRB2), and beta-adrenergic receptor kinase 2 (ADRBK2) genes". Genomics 23 (1): 286–8. 3. Parruti, G., Ambrosini, G., Sallese, M., De Blasi, A. Molecular cloning, functional expression and mRNA analysis of human beta-adrenergic receptor kinase 2. Biochem. Biophys. Res. Commun. 190: 475-481, 1993.
-
Gene Name
ADRBK2
-
Protein Name
Beta-adrenergic receptor kinase 2
-
Gene Full Name
adrenergic, beta, receptor kinase 2
-
Synonyms
ADRBK2 antibody|Adrenergic, beta, receptor kinase 2 antibody|ARBK2_HUMAN antibody|BARK2 antibody|Beta adrenergic receptor kinase 2 antibody|Beta ARK 2 antibody|Beta-adrenergic receptor kinase 2 antibody|Beta-ARK-2 antibody|EC 2.7.11.15 antibody|G protein coupled receptor kinase 3 antibody|G-protein-coupled receptor kinase 3 antibody|GRK3 antibody
-
Uniprot ID
P35626
-
Entrez GeneID
157
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
