PAR1 Antibody / F2R / Thrombin Receptor

• Catalog number
  R32032
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  PAR1 / F2R / Thrombin Receptor
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the Thrombin Receptor antibody should be determined by the researcher.
• Intented use
  This Thrombin Receptor antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P25116
• Purity
  Antigen affinity
• Description
  Proteinase-activated receptor 1 (PAR-1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.
• Immunogen
  Amino acids RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK of human PAR-1/Thrombin Receptor were used as the immunogen for the Thrombin Receptor antibody.
• Storage
  After reconstitution, the Thrombin Receptor antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• French translation
  anticorps

• Gene target
  PAR1   F2R   Thrombin   Receptor  
• Gene symbol
  F2R, PWAR1, SLC52A2
• Short name
  Anti-PAR1 / F2R / Thrombin Receptor
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to PAR1 / F2R / Thrombin Receptor
• Alternative technique
  antibodies
• Alternative to gene target
  coagulation factor II (thrombin) receptor, CF2R and HTR and PAR-1 and PAR1 and TR, F2R and IDBG-29671 and ENSG00000181104 and 2149, G-protein beta-subunit binding, Extracellular, F2r and IDBG-174004 and ENSMUSG00000048376 and 14062, BT.69975 and IDBG-645158 and ENSBTAG00000020199 and 526585

Gene info

• Identity
  HGNC:3537
• Gene
  F2R
• Long gene name
  coagulation factor II thrombin receptor
• Synonyms gene name
  • coagulation factor II (thrombin) receptor
• Synonyms
  • TR
  • CF2R
  • PAR1
  • PAR-1
• Synonyms name
  • protease activated receptor 1
• GenBank acession
  • M62424
• Locus
  5q13.3
• Discovery year
  1991-07-16
• Entrez gene record
  2149
• Pubmed identfication
  • 8395910
• RefSeq identity
  • NM_001992
• Classification
  • F2R receptors
• VEGA ID
  OTTHUMG00000131299
• Locus Specific Databases
  • LRG_641

Gene info

• Identity
  HGNC:30089
• Gene
  PWAR1
• Long gene name
  Prader Willi/Angelman region RNA 1
• Synonyms
  • PAR1
  • PAR-1
• Synonyms name
  • Prader Willi/Angelman region 1
• Locus
  15q11.2
• Discovery year
  2013-06-14
• Entrez gene record
  145624
• Pubmed identfication
  • 7987392
  • 9477342
• RefSeq identity
  • NR_022009
• Classification
  • Long non-coding RNAs with non-systematic symbols
• VEGA ID
  OTTHUMG00000176879

Gene info

• Identity
  HGNC:30224
• Gene
  SLC52A2
• Long gene name
  solute carrier family 52 member 2
• Synonyms gene
  • GPR172A
• Synonyms gene name
  • G protein-coupled receptor 172A
  • solute carrier family 52 (riboflavin transporter), member 2
• Synonyms
  • FLJ11856
  • PAR1
  • GPCR41
  • D15Ertd747e
  • RFVT2
  • hRFT3
• GenBank acession
  • AY070774
• Locus
  8q24.3
• Discovery year
  2004-07-19
• Entrez gene record
  79581
• Pubmed identfication
  • 12740431
• RefSeq identity
  • NM_024531
• Classification
  • Solute carriers
• VEGA ID
  OTTHUMG00000165168

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products