GPCR5A Blocking Peptide

Product Type

Proteins
Product Subtype

Blocking Peptides
Research Area

Signal Transduction
Tag Conjugate

SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
Type1

Synthetic
Form Buffer

Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage

Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications

WB, IHC
Shipping Info

Blue Ice
Test

You can block the antibody by the specific target amino acid sequence of peptide.
Properties

blocking peptide
Description

Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

Gene target

GPCR5A
Short name

GPCR5A Blocking Peptide
Technique

blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
Alternative name

GPCR5A inhibiting short protein sequence
Alternative technique

control, peptides

Name

Polymerase Chain Reaction
Concept

Scope note: In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
Tree numbers
- E05.393.620.500
Qualifiers

ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data