Rabbit GLRX3 antibody
-
Catalog number70R-4390
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenGLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
-
SpecificityGLRX3 antibody was raised against the N terminal of GLRX3
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLRX3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGLRX3
-
Short nameRabbit GLRX3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GLRX3 antibody raised against the N terminal of GLRX3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetglutaredoxin 3, GLRX4 and GRX3 and GRX4 and PICOT and TXNL2 and TXNL3, GLRX3 and IDBG-93235 and ENSG00000108010 and 10539, iron-sulfur cluster binding, nuclei, Glrx3 and IDBG-211431 and ENSMUSG00000031068 and 30926, GLRX3 and IDBG-641075 and ENSBTAG00000005027 and 511528
-
Gene info
-
Identity
-
Gene
-
Long gene nameglutaredoxin 3
-
Synonyms gene
-
Synonyms gene name
- thioredoxin-like 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-06-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Glutaredoxin domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data