Rabbit GLRX3 antibody

  • Catalog number
    70R-4390
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
  • Specificity
    GLRX3 antibody was raised against the N terminal of GLRX3
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLRX3 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    GLRX3  
  • Gene symbol
    GLRX3
  • Short name
    Rabbit GLRX3 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal GLRX3 antibody raised against the N terminal of GLRX3
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    glutaredoxin 3, GLRX4 and GRX3 and GRX4 and PICOT and TXNL2 and TXNL3, GLRX3 and IDBG-93235 and ENSG00000108010 and 10539, iron-sulfur cluster binding, nuclei, Glrx3 and IDBG-211431 and ENSMUSG00000031068 and 30926, GLRX3 and IDBG-641075 and ENSBTAG00000005027 and 511528
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee