GBA3 Blocking Peptide

GBA3 Blocking Peptide is available 2 times from Fitzgerald labs

  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Cell Biology
  • Tag/Conjugate
    LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH
  • Type1
    Synthetic
  • Form & Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Cell Biology
  • Residues
    LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH
  • Type of protein
    Synthetic
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Short name
    GBA3 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide
  • Alternative name
    GBA3 inhibiting short protein sequence
  • Alternative technique
    control

33R-5474 | GBA3 Blocking Peptidesize: 100 ug | 326.9 USD

Ajax processing

33R-5474 | GBA3 Blocking Peptidesize: 100 µg | 245.18 USD

Ajax processing
Simillar products
Supplier:abbex
Price:354.92USD
Supplier:ABM microrna
Price:1 520.09USD
Supplier:MyBioSource
Price:0.00USD
Supplier:genways
Price:608.27USD
Supplier:Assay Biotech
Price:618.78USD
Supplier:The Request
Price:157.61USD
Supplier:Cusabio
Price:247.51USD
Supplier:EnoGene
Price:437.81USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MBS Recombinant
Price:1 613.49USD
Supplier:Bioss Polyclonal Antibodies
Price:570.91USD
Supplier:agisera
Price:642.13USD
Supplier:MyBioSource
Price:0.00USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
GBA3 Blocking Peptide - Gentaur.com
Contact
Chat with gentaur.com employee