FMRP Antibody

  • Catalog number
    PB9703
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    FMRP
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the FMRP Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The FMRP Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mentalretardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
  • Related articles
    1. Verkerk AJ, Pieretti M, Sutcliffe JS, Fu YH, Kuhl DP, Pizzuti A, Reiner O, Richards S, Victoria MF, Zhang FP (May 1991). "Identification of a gene (FMR-1) containing a CGG repeat coincident with a breakpoint cluster region exhibiting length variation in fragile X syndrome". Cell 65(5): 905–14. 2. Verheij C, Bakker CE, de Graaff E, Keulemans J, Willemsen R, Verkerk AJ, Galjaard H, Reuser AJ, Hoogeveen AT, Oostra BA (June 1993). "Characterization and localization of the FMR-1 gene product associated with fragile X syndrome". Nature 363 (6431): 722–4.
  • Gene Name
    FMR1
  • Protein Name
    Synaptic functional regulator FMR1
  • Gene Full Name
    fragile X mental retardation 1
  • Synonyms
    FMR 1 antibody|Fmr1 antibody|Fmr1 gene antibody|FMR1_HUMAN antibody|FMRP antibody|Fragile X mental retardation 1 antibody|Fragile X mental retardation 1 protein antibody|Fragile X mental retardation protein 1 antibody|FRAXA antibody|MGC87458 antibody|POF antibody| POF1 antibody|Protein FMR-1 antibody|Protein FMR1 antibody
  • Uniprot ID
    Q06787
  • Entrez GeneID
    2332
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    FMRP  
  • Gene symbol
    FMR1
  • Short name
    FMRP Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    FMRP (antibody to-)
  • Alternative technique
    antibodies
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee