-
Target antigen
Fetuin A
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P,ELISA
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Fetuin A Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Fetuin A Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
-
Related articles
1. "Entrez Gene: AHSG alpha-2-HS-glycoprotein". 2. Osawa M, Umetsu K, Sato M, Ohki T, Yukawa N, Suzuki T, Takeichi S (September 1997). "Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG)". Gene 196 (1-2): 121–5. 3. Rizzu P, Baldini A (1995). "Three members of the human cystatin gene superfamily, AHSG, HRG, and KNG, map within one megabase of genomic DNA at 3q27". Cytogenet. Cell Genet. 70 (1-2): 26–8.
-
Gene Name
AHSG
-
Protein Name
Alpha-2-HS-glycoprotein
-
Gene Full Name
alpha-2-HS-glycoprotein
-
Synonyms
59 kDa bone sialic acid-containing protein antibody|A2HS antibody|Aa2-066 antibody|AHS antibody|Ahsg alpha-2-HS-glycoprotein antibody| Ahsg antibody|Alpha 2 HS Glycoprotein antibody|Alpha 2 Z globulin antibody|Alpha-2-HS-glycoprotein antibody|Alpha-2-HS-glycoprotein chain B antibody|Alpha-2-Z-globulin antibody|Asialofetuin antibody|Ba alpha 2 glycoprotein antibody|Ba-alpha-2-glycoprotein antibody| BSP antibody|Countertrypin antibody|Fetua antibody|FETUA_HUMAN antibody|Fetuin, mouse, homolog of antibody| Fetuin A antibody|Fetuin-A antibody|Glycoprotein PP63 antibody|HSGA antibody|pp63 antibody
-
Uniprot ID
P02765
-
Entrez GeneID
197
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
