Factor XIII B Polypeptide Blocking Peptide
-
Catalog number
33R-6368
-
Price
Please ask
-
Size
100 µg
-
-
Category
Proteins
-
Antibody Subtype
Blocking Peptides
-
Area of research
Signal Transduction
-
Residues
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMS
-
Type of protein
Synthetic
-
Form Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
-
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
-
Shipping conditions
Blue Ice
-
Tested for
WB; IHC
-
-
-
Test
You can block the antibody by the specific target amino acid sequence of peptide.
-
Properties
blocking peptide
-
Description
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
-
Gene target
-
Gene symbol
F13B
-
Short name
Factor XIII B Polypeptide Blocking Peptide
-
Technique
blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
-
Alternative name
A synthetic peptide for use as a blocking control in assays to test for specificity of F13B antibody, catalog no. 70R-5445
-
Alternative technique
control, peptides
-
Gene info
Similar products