DDAH2 Antibody

• Catalog number
  R32438
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  DDAH2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This DDAH2 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O95865
• Purity
  Antigen affinity
• Description
  DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.
• Immunogen
  Amino acids DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR were used as the immunogen for the DDAH2 antibody.
• Storage
  Prior to reconstitution, store at 4oC. After reconstitution, the DDAH2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic, membranous
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  DDAH2  
• Gene symbol
  DDAH2
• Short name
  Anti- DDAH2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to DDAH2
• Alternative technique
  antibodies
• Alternative to gene target
  dimethylarginine dimethylaminohydrolase 2, DDAH and DDAHII and G6a and HEL-S-277 and NG30, DDAH2 and IDBG-238590 and ENSG00000213722 and 23564, hydrolase activity, Cytoplasm, Ddah2 and IDBG-176274 and ENSMUSG00000007039 and 51793, DDAH2 and IDBG-633979 and ENSBTAG00000013530 and 540386

Gene info

• Identity
  HGNC:2716
• Gene
  DDAH2
• Long gene name
  dimethylarginine dimethylaminohydrolase 2
• Synonyms
  • G6A
• GenBank acession
  • AF070667
• Locus
  6p21.33
• Discovery year
  1999-10-22
• Entrez gene record
  23564
• Pubmed identfication
  • 10493931
• VEGA ID
  OTTHUMG00000031212

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products