CXCR6 Blocking Peptide

CXCR6 Blocking Peptide is available 2 times from Fitzgerald labs

  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Cell Biology
  • Residues
    AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
  • Type of protein
    Synthetic
  • Form & Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Cell Biology
  • Tag/Conjugate
    AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
  • Type1
    Synthetic
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Short name
    CXCR6 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide
  • Alternative name
    chemokine (C-X-C motif) receptor 6 inhibiting short protein sequence
  • Alternative technique
    control
  • Alternative to gene target
    chemokine (C-X-C motif) receptor 6, BONZO and CD186 and STRL33 and TYMSTR, CXCR6 and IDBG-29993 and ENSG00000172215 and 10663, C-X-C chemokine receptor activity, Plasma membranes, Cxcr6 and IDBG-206490 and ENSMUSG00000048521 and 80901, CXCR6 and IDBG-646261 and ENSBTAG00000015708 and 506807

33R-1131 | CXCR6 Blocking Peptidesize: 100 µg | 245.18 USD

Ajax processing

33R-1131 | CXCR6 Blocking Peptidesize: 100 ug | 326.9 USD

Ajax processing
Simillar products
Supplier:ABM microrna
Price:1 437.19USD
Supplier:EnoGene
Price:437.81USD
Supplier:MBS Polyclonals
Price:309.39USD
Supplier:MBS Recombinant
Price:1 586.63USD
Supplier:MBS Recombinant
Price:1 361.31USD
Supplier:Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price:388.49USD
Supplier:abm Adinovirus
Price:769.38USD
Supplier:acr
Price:380.61USD
Supplier:Cloud Clone Corp
Price:373.60USD
Supplier:aviva
Price:495.02USD
Supplier:MBS Recombinant
Price:2 380.53USD
Supplier:aviva
Price:495.02USD
Supplier:Bioss Primary Unconjugated Antibodies
Price:328.07USD
Supplier:MyBioSource
Price:0.00USD
Supplier:ABM lentivectors
Price:376.52USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
CXCR6 Blocking Peptide - Gentaur.com
Contact
Chat with gentaur.com employee