CXCR4 Antibody
-
Catalog numberA00031
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenCXCR4
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the CXCR4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe CXCR4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundCXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.
-
Related articles1. Caruz, A.; Samsom, M.; Alonso, J. M.; Alcami, J.; Baleux, F.; Virelizier, J. L.; Parmentier, M.; Arenzana-Seisdedos, F. : Genomic organization and promoter characterization of human CXCR4 gene. FEBS Lett. 426: 271-278, 1998. 2. Tachibana, K.; Hirota, S.; Iizasa, H.; Yoshida, H.; Kawabata, K.; Kataoka, Y.; Kitamura, Y.; Matsushima, K.; Yoshida, N.; Nishikawa, S.; Kishimoto, T.; Nagasawa, T. : The chemokine receptor CXCR4 is essential for vascularization of the gastrointestinal tract. Nature 393: 591-594, 1998.
-
Gene NameCXCR4
-
Protein NameC-X-C chemokine receptor type 4
-
Gene Full Namechemokine (C-X-C motif) receptor 4
-
SynonymsC-X-C chemokine receptor type 4 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | Leukocyte-derived seven transmembrane domain receptor | LESTR Lipopolysaccharide-associated protein 3 | LAP-3 | LPS-associated protein 3 | NPYRL | Stromal cell-derived factor 1 receptor | SDF-1 receptor | CD184 | CXCR4 | P61073
-
Uniprot IDP61073
-
Entrez GeneID7852
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolCXCR4
-
Short nameCXCR4 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative namechemokine (C-X-C motif) receptor 4 (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetchemokine (C-X-C motif) receptor 4, CD184 and D2S201E and FB22 and HM89 and HSY3RR and LAP-3 and LAP3 and LCR1 and LESTR and NPY3R and NPYR and NPYRL and NPYY3R and WHIM, CXCR4 and IDBG-71032 and ENSG00000121966 and 7852, ubiquitin binding, Cell surfaces, Cxcr4 and IDBG-189999 and ENSMUSG00000045382 and 12767, CXCR4 and IDBG-642187 and ENSBTAG00000001060 and 281736
-
Gene info
-
Identity
-
Gene
-
Long gene nameC-X-C motif chemokine receptor 4
-
Synonyms gene name
- chemokine (C-X-C motif), receptor 4 (fusin)
- chemokine (C-X-C motif) receptor 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-09-17
-
Entrez gene record
-
Pubmed identfication
-
Classification
- C-X-C motif chemokine receptors
- CD molecules
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data