Rabbit COMT antibody

• Catalog number
  70R-7143
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Drugs & Toxicology
• Immunogen
  COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
• Specificity
  COMT antibody was raised against the middle region of COMT
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COMT antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  COMT  
• Gene symbol
  COMT
• Short name
  Rabbit COMT antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal COMT antibody raised against the middle region of COMT
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  catechol-O-methyltransferase, HEL-S-98n, COMT and IDBG-1506 and ENSG00000093010 and 1312, catechol O-methyltransferase activity, Plasma membranes, Comt and IDBG-141739 and ENSMUSG00000000326 and 12846, COMT and IDBG-638156 and ENSBTAG00000019516 and 618278

Gene info

• Identity
  HGNC:2228
• Gene
  COMT
• Long gene name
  catechol-O-methyltransferase
• Locus
  22q11.21
• Discovery year
  2001-06-22
• Entrez gene record
  1312
• Pubmed identfication
  • 1572656
• RefSeq identity
  • NM_000754
• Classification
  • MicroRNA protein coding host genes
  • 7BS small molecule methyltransferases
• VEGA ID
  OTTHUMG00000150529
• Locus Specific Databases
  • LRG_1010

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products