Chst11 Blocking Peptide

• Catalog number
  33R-2875
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Cell Biology
• Residues
  FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  Chst11  
• Gene symbol
  CHST11
• Short name
  Chst11 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of Chst11 antibody, catalog no. 70R-8685
• Alternative technique
  control, peptides
• Alternative to gene target
  carbohydrate (chondroitin 4) sulfotransferase 11, CHST11 and IDBG-54479 and ENSG00000171310 and 50515, N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity, Plasma membranes, Chst11 and IDBG-179952 and ENSMUSG00000034612 and 58250, CHST11 and IDBG-637500 and ENSBTAG00000010644 and 528860

Gene info

• Identity
  HGNC:17422
• Gene
  CHST11
• Long gene name
  carbohydrate sulfotransferase 11
• Synonyms gene name
  • carbohydrate (chondroitin 4) sulfotransferase 11
• Synonyms
  • C4ST1
  • C4St-1
  • C4ST
  • HSA269537
• Synonyms name
  • chondroitin 4-sulfotransferase 1
• GenBank acession
  • AB042326
• Locus
  12q23.3
• Discovery year
  2003-08-06
• Entrez gene record
  50515
• Pubmed identfication
  • 10781601
  • 29514872
• RefSeq identity
  • NM_018413
• Classification
  • Sulfotransferases, membrane bound
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000169803

Similar products