-
Target antigen
CDK5R1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CDK5R1 (11-44aa YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the CDK5R1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The CDK5R1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
CDK5R1 is also known as p35, CDK5R or NCK5A. The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.
-
Related articles
1. Schizophrenia is associated with dysregulation of a Cdk5 activator that regulates synaptic protein expression and cognition.Engmann O, et al. Brain, 2011 Aug. 2. Cdk5/p35 is required for motor coordination and cerebellar plasticity.He X, et al. J Neurochem, 2014 Oct. 3. CDK5 and its activator P35 in normal pituitary and in pituitary adenomas: relationship to VEGF expression.Xie W, et al. Int J Biol Sci, 2014.
-
Gene Name
CDK5R1
-
Protein Name
Cyclin-dependent kinase 5 activator 1
-
Gene Full Name
cyclin-dependent kinase 5, regulatory subunit 1 (p35)
-
Synonyms
CD5R1_HUMAN antibody|CDK 5R1 antibody|CDK5 activator 1 antibody|CDK5P35 antibody|CDK5R antibody|CDK5R1 antibody|Cyclin dependent kinase 5 activator 1 antibody|Cyclin dependent kinase 5 regulatory subunit 1 antibody|Cyclin-dependent kinase 5 activator 1 antibody|Cyclin-dependent kinase 5 regulatory subunit 1 antibody|MGC33831 antibody|NCK 5A antibody|NCK5A antibody|Neuronal CDK5 activator antibody|p23 antibody|p25 antibody|p25 included antibody|p35 antibody|p35nck5a antibody|Regulatory partner for CDK5 kinase antibody|Tau protein kinase II 23 kDa subunit antibody|Tau protein kinase II 23kDa subunit antibody|TPKII regulatory subunit antibody
-
Uniprot ID
Q15078
-
Entrez GeneID
8851
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps