CD27 Blocking Peptide

Product Type

Proteins
Product Subtype

Blocking Peptides
Research Area

Cell Biology
Tag Conjugate

LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP
Type1

Synthetic
Form Buffer

Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage

Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications

WB, IHC
Shipping Info

Blue Ice
Test

You can block the antibody by the specific target amino acid sequence of peptide.
Properties

blocking peptide
Description

Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

Gene target

CD27
Gene symbol

CD27-AS1, CD27
Short name

CD27 Blocking Peptide
Technique

blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
Alternative name

CD27 molecule inhibiting short protein sequence
Alternative technique

control, peptides
Alternative to gene target

CD27 molecule, S152 and S152. LPFS2 and T14 and TNFRSF7 and Tp55, CD27 and IDBG-14014 and ENSG00000139193 and 939, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, Extracellular, Cd27 and IDBG-189750 and ENSMUSG00000030336 and 21940, CD27 and IDBG-640494 and ENSBTAG00000014725 and 512514