RUNX2 Antibody

• Catalog number
  R31577
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  RUNX2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.5-1ug/ml
• Notes
  The stated application concentrations are suggested starting amounts. Titration of the RUNX2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
• Intented use
  This RUNX2 antibodyis to be used only for research purposes and not for diagnostics..
• Gene ID
  860
• Purity
  Antigen affinity
• Description
  Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
• Immunogen
  An amino acid sequence from the middle region of human RUNX2 (DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN) was used as the immunogen for this RUNX2 antibody (100% mouse homology).
• Storage
  After reconstitution, the RUNX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  RUNX2  
• Gene symbol
  RUNX2-AS1, RUNX2
• Short name
  Anti-RUNX2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to RUNX2
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:53512
• Gene
  RUNX2-AS1
• Long gene name
  RUNX2 antisense RNA 1
• Locus
  6p21.1
• Discovery year
  2017-05-12
• Entrez gene record
  105375077
• Classification
  • Antisense RNAs

Gene info

• Identity
  HGNC:10472
• Gene
  RUNX2
• Long gene name
  RUNX family transcription factor 2
• Synonyms gene
  • CCD
  • CBFA1
  • CCD1
• Synonyms gene name
  • runt-related transcription factor 2
  • runt related transcription factor 2
• Synonyms
  • AML3
  • PEBP2A1
  • PEBP2aA1
• GenBank acession
  • AF001450
• Locus
  6p21.1
• Discovery year
  1994-11-02
• Entrez gene record
  860
• Pubmed identfication
  • 7835892
• RefSeq identity
  • NM_004348
• Classification
  • Runt-related transcription factors
• VEGA ID
  OTTHUMG00000014774

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products