CAMK1D Blocking Peptide

• Catalog number
  33R-4567
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Signal Transduction
• Tag Conjugate
  KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  CAMK1D  
• Gene symbol
  CAMK1D
• Short name
  CAMK1D Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  calcium/calmodulin-dependent protein phosphorylation catalyst ID inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  calcium/calmodulin-dependent protein kinase ID, CAMK1D and IDBG-54250 and ENSG00000183049 and 57118, transferase activity, nuclei, Camk1d and IDBG-134225 and ENSMUSG00000039145 and 227541, CAMK1D and IDBG-636735 and ENSBTAG00000008650 and 526873

Gene info

• Identity
  HGNC:19341
• Gene
  CAMK1D
• Long gene name
  calcium/calmodulin dependent protein kinase ID
• Synonyms gene name
  • calcium/calmodulin-dependent protein kinase ID
• Synonyms
  • CKLiK
• GenBank acession
  • AF286366
• Locus
  10p13
• Discovery year
  2003-11-05
• Entrez gene record
  57118
• Pubmed identfication
  • 11050006
• RefSeq identity
  • NM_020397
• Classification
  • MicroRNA protein coding host genes
  • Calmodulin dependent protein kinases
• VEGA ID
  OTTHUMG00000017683

Similar products