BTC, human recombinant

• Catalog number
  4876-20
• Price
  Please ask
• Size
  20 ug

• Synonyms
  Betacellulin, BTC
• Alternative_names
  Betacellulin, BTC, Probetacellulin
• Description
  A ligand for the EGF receptor
• Recombinant
  Yes
• Source
  E. coli
• Purity by SDS PAGE
  ≥97%
• Assay
  SDS-PAGE
• Purity
  ≥97%
• Biological activity
  The ED₅₀, calculated by the dose-dependant proliferation of murine BALB\C 3T3 cells (measured by 3H-thymidine uptake) is < 0.05 ng/ml; corresponding to a Specific Activity of > 2.0 ×10⁷IU/mg.
• Molecular Weight
  9.0 kDa
• Storage Temp
  -20°C
• Shipping
  Blue ice
• Shelf Life
  12 months
• Appearance
  Lyophilized protein
• Physical form description
  Lyophilized after extensive dialysis against 20 mM phosphate buffer, pH 7.4.
• Reconstitution Instructions
  Centrifuge the vial prior to opening. Reconstitute in sterile distilled H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
• Background Information
  Human Betacellulin (BTC) is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the egf receptor and other related receptors. Human Recombinant BTC produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 80 amino acids and having a molecular mass of 9 kDa. BTC was purified by proprietary chromatographic techniques.
• Amino acid sequence
  DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVA EQTPSCVCDEGYIGARCERVDLFY
• Handling
  Centrifuge the vial prior to opening.
• Usage
  For Research Use Only! Not to be used in humans
• Datasheet
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  BTC  
• Gene symbol
  BTC
• Short name
  BTC, recombinant
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  betacellulin, H. sapiens Rec.
• Alternative technique
  rec
• Alternative to gene target
  betacellulin, BTC and IDBG-24477 and ENSG00000174808 and 685, growth factor activity, Extracellular, Btc and IDBG-394187 and ENSMUSG00000082361 and 12223, BTC and IDBG-643041 and ENSBTAG00000004237 and 280737

Gene info

• Identity
  HGNC:1121
• Gene
  BTC
• Long gene name
  betacellulin
• GenBank acession
  • S55606
• Locus
  4q13.3
• Discovery year
  1994-07-21
• Entrez gene record
  685
• Pubmed identfication
  • 8439318
  • 11522793
• VEGA ID
  OTTHUMG00000130107

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products