BECN1 Blocking Peptide

• Catalog number
  33R-6603
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  BECN1  
• Gene symbol
  BECN1
• Short name
  BECN1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  beclin 1, autophagy related inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  beclin 1, autophagy related, ATG6 and beclin1 and VPS30, BECN1 and IDBG-51769 and ENSG00000126581 and 102725513,8678, sequence-specific DNA binding, Plasma membranes, Becn1 and IDBG-212053 and ENSMUSG00000035086 and 56208, BECN1 and IDBG-640456 and ENSBTAG00000019914 and 527278

Gene info

• Identity
  HGNC:1034
• Gene
  BECN1
• Long gene name
  beclin 1
• Synonyms gene name
  • beclin 1 (coiled-coil, moesin-like BCL2 interacting protein)
  • beclin 1, autophagy related
• Synonyms
  • ATG6
  • VPS30
• Synonyms name
  • ATG6 autophagy related 6 homolog (S. cerevisiae)
• GenBank acession
  • AF077301
• Locus
  17q21.31
• Discovery year
  1998-11-27
• Entrez gene record
  8678
• Pubmed identfication
  • 9765397
• RefSeq identity
  • NM_003766
• Classification
  • PIK3C3 complex subunits
  • MicroRNA protein coding host genes
  • Autophagy related
• VEGA ID
  OTTHUMG00000180653

Similar products