ATP2A1 Antibody

• Catalog number
  R30155
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  ATP2A1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  The stated application concentrations are suggested starting amounts. Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
• Intented use
  This ATP2A1 antibodyis to be used only for research purposes and not for diagnostics..
• Gene ID
  487
• Purity
  Antigen affinity
• Description
  SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.
• Immunogen
  An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.
• Storage
  After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ATP2A1  
• Gene symbol
  ATP2A1-AS1, ATP2A1
• Short name
  Anti-ATP2A1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to ATP2A1
• Alternative technique
  antibodies
• Alternative to gene target
  ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, ATP2A and SERCA1, ATP2A1 and IDBG-23611 and ENSG00000196296 and 487, metal ion binding, Plasma membranes, Atp2a1 and IDBG-209499 and ENSMUSG00000030730 and 11937, BT.62768 and IDBG-638938 and ENSBTAG00000006541 and 518117

Gene info

• Identity
  HGNC:51370
• Gene
  ATP2A1-AS1
• Long gene name
  ATP2A1 antisense RNA 1
• GenBank acession
  • BX099641
  • AI015924
• Locus
  16p11.2
• Discovery year
  2014-10-16
• Entrez gene record
  100289092
• RefSeq identity
  • NR_046287
• Classification
  • Antisense RNAs
• VEGA ID
  OTTHUMG00000176592

Gene info

• Identity
  HGNC:811
• Gene
  ATP2A1
• Long gene name
  ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
• Synonyms gene
  • ATP2A
• Synonyms gene name
  • ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
• Synonyms
  • SERCA1
• Synonyms name
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  • calcium pump 1
• Locus
  16p11.2
• Discovery year
  1990-09-10
• Entrez gene record
  487
• RefSeq identity
  • NM_004320
• Classification
  • ATPases Ca2+ transporting
• VEGA ID
  OTTHUMG00000131760

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products