Rabbit DCLRE1C antibody
-
Catalog number70R-2289
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenDCLRE1C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCLRE1C antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDCLRE1C
-
Short nameRabbit DCLRE1C antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DCLRE1C antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetDNA cross-link repair 1C, DCLRE1C and IDBG-56338 and ENSG00000152457 and 64421, hydrolase activity, nuclei, Dclre1c and IDBG-133199 and ENSMUSG00000026648 and 227525, DCLRE1C and IDBG-638047 and ENSBTAG00000010220 and 517886
-
Gene info
-
Identity
-
Gene
-
Long gene nameDNA cross-link repair 1C
-
Synonyms gene
-
Synonyms gene name
- severe combined immunodeficiency, type a (Athabascan)
- DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-01-18
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- DNA cross-link repair family
- MBL fold containing DNA/RNA interacting subfamily
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data