ARID1A Antibody

  • Catalog number
    PB9685
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    ARID1A
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the ARID1A Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The ARID1A Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.
  • Related articles
    1. Dallas, P. B., Pacchione, S., Wilsker, D., Bowrin, V., Kobayashi, R., Moran, E. The human SWI-SNF complex protein p270 is an ARID family member with non-sequence-specific DNA binding activity. Molec. Cell. Biol. 20: 3137-3146, 2000. 2. Krosl, J., Mamo, A., Chagraoui, J., Wilhelm, B. T., Girard, S., Louis, I., Lessard, J., Perreault, C., Sauvageau, G. A mutant allele of the Swi/Snf member BAF250a determines the pool size of fetal liver hemopoietic stem cell populations. Blood 116: 1678-1684, 2010. 3. Nie, Z., Xue, Y., Yang, D., Zhou, S., Deroo, B. J., Archer, T. K., Wang, W. A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex. Molec. Cell. Biol. 20: 8879-8888, 2000.
  • Gene Name
    ARID1A
  • Protein Name
    AT-rich interactive domain-containing protein 1A
  • Gene Full Name
    AT rich interactive domain 1A (SWI-like)
  • Synonyms
    actin-dependent regulator of chromatin subfamily F member 1 antibody|ARI1A_HUMAN antibody| ARID domain containing protein 1A antibody|ARID domain-containing protein 1A antibody| ARID1A antibody|AT rich interactive domain 1A (SWI like) antibody|AT rich interactive domain 1A antibody|AT rich interactive domain containing protein 1A antibody|AT-rich interactive domain-containing protein 1A antibody|B120 antibody|BAF250 antibody|BAF250A antibody|BM029 antibody|brain protein 120 antibody|BRG1 associated factor 250 antibody|BRG1 associated factor 250a antibody|BRG1-associated factor 250 antibody|BRG1-associated factor 250a antibody|C1ORF4 antibody|chromatin remodeling factor p250 antibody|chromosome 1 open reading frame 4 antibody|hELD antibody|hOSA1 antibody|matrix-associated antibody|Osa homolog 1 antibody|OSA1 antibody|OSA1 nuclear protein antibody|P270 antibody|SMARCF1 antibody|SWI like protein antibody|SWI SNF complex protein p270 antibody|SWI-like protein antibody|SWI/SNF complex protein p270 antibody|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1 antibody|SWI/SNF-related antibody
  • Uniprot ID
    O14497
  • Entrez GeneID
    8289
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    ARID1A  
  • Gene symbol
    ARID1A
  • Short name
    ARID1A Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    ARID1A (antibody to-)
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    AT-rich interaction domain 1A
  • Synonyms gene
  • Synonyms gene name
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1
    • AT rich interactive domain 1A (SWI- like)
    • AT rich interactive domain 1A (SWI-like)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-06-26
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • BAF complex
    • Armadillo like helical domain containing
    • AT-rich interaction domain containing
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee