APLP1 Antibody

• Catalog number
  R32129
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  APLP1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the APLP1 antibody should be determined by the researcher.
• Intented use
  This APLP1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P51693
• Purity
  Antigen affinity
• Description
  Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.
• Immunogen
  Amino acids RRCLRDPQRVLEYCRQMYPELQIARVEQATQ of human APLP1 were used as the immunogen for the APLP1 antibody.
• Storage
  After reconstitution, the APLP1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic, membrane
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  APLP1  
• Gene symbol
  APLP1
• Short name
  Anti-APLP1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to APLP1
• Alternative technique
  antibodies
• Alternative to gene target
  amyloid beta (A4) precursor-like protein 1, APLP, APLP1 and IDBG-45875 and ENSG00000105290 and 333, transition metal ion binding, Plasma membranes, Aplp1 and IDBG-168935 and ENSMUSG00000006651 and 11803, BT.56047 and IDBG-636032 and ENSBTAG00000001151 and 513154

Gene info

• Identity
  HGNC:597
• Gene
  APLP1
• Long gene name
  amyloid beta precursor like protein 1
• Synonyms gene name
  • amyloid beta (A4) precursor-like protein 1
• Synonyms
  • APLP
• Synonyms name
  • amyloid-like protein 1
  • amyloid precursor-like protein 1
• GenBank acession
  • U48437
• Locus
  19q13.12
• Discovery year
  1992-06-18
• Entrez gene record
  333
• Pubmed identfication
  • 8432545
• RefSeq identity
  • NM_001024807
• VEGA ID
  OTTHUMG00000180692

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products