Anti-IL7R/CD127 Picoband Antibody

Anti-IL7R/CD127 Picoband Antibody is available 1 time from Boster labs

  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage & Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross-reactivity
    No cross reactivity with other proteins
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human, Rat
  • Applications
    WB
  • Reactivity
    Human, Rat
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=PB9948
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    Anti-IL7R/CD127 Picoband Antibody
  • Technique
    Antibody, anti
  • Alternative name
    antibody to-interleukin 7 receptor/CD127 Picoband (Antibody to)
  • Alternative technique
    antibodies
  • Alternative to gene target
    interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, this GO :0000018 and regulation of DNA recombination and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0001915 and negative regulation of T cell mediated cytotoxicity and biological process this GO :0002377 and immunoglobulin production and biological process this GO :0003823 and antigen binding and molecular function this GO :0004896 and cytokine receptor activity and molecular function this GO :0004917 and interleukin-7 receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008361 and regulation of cell size and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016049 and cell growth and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0038111 and interleukin-7-mediated signaling pathway and biological process this GO :0042100 and B cell proliferation and biological process this GO :0048535 and lymph node development and biological process this GO :0048872 and homeostasis of number of cells and biological process, protein binding, this GO :0003823: antigen binding and also this GO :0004896: cytokine receptor activity and also this GO :0004917: interleukin-7 receptor activity and also this GO :0005515: protein binding, this GO :0003823: antigen binding, this GO :0004896: cytokine receptor activity, this GO :0004917: interleukin-7 receptor activity, this GO :0005515: protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554

PB9948 | Anti-IL7R/CD127 Picoband Antibodysize: 100µg/vial | 480.05 USD

Ajax processing
Simillar products
Supplier:ABM lentivectors
Price:1 384.76USD
Supplier:abbex
Price:374.19USD
Supplier:abm Adinovirus
Price:1 061.04USD
Supplier:ABM microrna
Price:1 602.63USD
Supplier:trca
Price:374.19USD
Supplier:ABM microrna
Price:311.42USD
Supplier:MBS Polyclonals
Price:326.19USD
Supplier:SFC
Price:0.00USD
Supplier:trca
Price:240.03USD
Supplier:trca
Price:177.25USD
Supplier:BlueGen ELISAs
Price:744.69USD
Supplier:ABM microrna
Price:1 602.63USD
Supplier:MBS Polyclonals
Price:761.93USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Anti-IL7R/CD127 Picoband Antibody - Gentaur.com
Contact
Chat with gentaur.com employee