Anti-IL7R/CD127 Picoband Antibody

Anti-IL7R/CD127 Picoband Antibody is available 1 time from Boster labs

PB9948 | Anti-IL7R/CD127 Picoband Antibodysize: 100µg/vial | 458.6 USD

Ajax processing
  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage & Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross-reactivity
    No cross reactivity with other proteins
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human, Rat
  • Applications
    WB
  • Reactivity
    Human, Rat
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=PB9948
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    Anti-IL7R/CD127 Picoband Antibody
  • Technique
    Antibody, anti
  • Alternative name
    antibody to-interleukin 7 receptor/CD127 Picoband (Antibody to)
  • Alternative technique
    antibodies
  • Alternative to gene target
    interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554
Simillar products
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:475.06USD
Supplier:abm Adinovirus
Price:774.92USD
Supplier:BlueGen ELISAs
Price:711.42USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:838.42USD
Supplier:MyBioSource
Price:0.00USD
Supplier:acr
Price:408.04USD
Supplier:MAGNA MEDICS
Price:364.53USD
Supplier:MyBioSource
Price:259.87USD
Supplier:MyBioSource
Price:0.00USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Anti-IL7R/CD127 Picoband Antibody - Gentaur.com
Contact
Chat with gentaur.com employee