EXOC6 antibody

• Catalog number
  70R-3769
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  EXOC6 antibodies were raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI
• Raised in
  Rabbit
• Specificity
  EXOC6 antibody was raised against the N terminal of EXOC6
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOC6 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  EXOC6 Blocking Peptide, catalog no. 33R-6184, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody
• Additional Information
  This is a rabbit polyclonal antibody against EXOC6, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  EXOC6  
• Gene symbol
  EXOC6
• Short name
  EXOC6 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal EXOC6 antibody raised against the N terminal of EXOC6
• Alternative technique
  antibodies
• Alternative to gene target
  exocyst complex component 6, EXOC6 and IDBG-82578 and ENSG00000138190 and 54536, Plasma membranes, Exoc6 and IDBG-161780 and ENSMUSG00000053799 and 107371, BT.47793 and IDBG-637615 and ENSBTAG00000021116 and 507518

Gene info

• Identity
  HGNC:23196
• Gene
  EXOC6
• Long gene name
  exocyst complex component 6
• Synonyms gene
  • SEC15L1
• Synonyms gene name
  • SEC15-like 1 (S. cerevisiae)
• Synonyms
  • SEC15L
  • FLJ1125
  • DKFZp761I2124
  • MGC33397
  • Sec15p
  • EXOC6A
• GenBank acession
  • BC028395
• Locus
  10q23.33
• Discovery year
  2003-10-06
• Entrez gene record
  54536
• Pubmed identfication
  • 8889548
• RefSeq identity
  • NM_019053
• Classification
  • Exocyst complex
• VEGA ID
  OTTHUMG00000018767

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products