-
Target antigen
HSPA2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the HSPA2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The HSPA2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
-
Related articles
1. Bonnycastle, L. L. C., Yu, C.-E., Hunt, C. R., Trask, B. J., Clancy, K. P., Weber, J. L., Patterson, D., Schellenberg, G. D. Cloning, sequencing, and mapping of the human chromosome 14 heat shock protein gene (HSPA2). Genomics 23: 85-93, 1994. 2. Dix, D. J., Allen, J. W., Collins, B. W., Mori, C., Nakamura, N., Poorman-Allen, P., Goulding, E. H., Eddy, E. M. Targeted gene disruption of Hsp70-2 results in failed meiosis, germ cell apoptosis, and male infertility. Proc. Nat. Acad. Sci. 93: 3264-3268, 1996. 3. Hunt, C. R., Gasser, D. L., Chaplin, D. D., Pierce, J. C., Kozak, C. A. Chromosomal localization of five murine HSP70 gene family members: Hsp70-1, Hsp70-2, Hsp70-3, Hsc70t and Grp78. Genomics 16: 193-198, 1993.
-
Gene Name
HSPA2
-
Protein Name
Heat shock-related 70 kDa protein 2
-
Gene Full Name
heat shock 70kDa protein 2
-
Synonyms
70kDa antibody|DAQB 147D11.1 001 antibody|Hcp70.2 antibody|Heat shock 70 kDa protein 2 antibody|heat shock 70kDa protein 1A antibody| Heat shock protein 2 antibody|heat shock protein 70 antibody|Heat shock protein 70.2 antibody|Heat shock related 70 kDa protein 2 antibody|Heat shock-related 70 kDa protein 2 antibody|Heat-shock protein, 70-KD, 2 antibody|Heat-shock protein, 70-KD, 3 antibody| HSP70 2 antibody|HSP70 3 antibody|Hsp70-2 antibody|HSP70-3 antibody|HSP70.2 antibody|HSP70A2 antibody|HSP72 antibody|HSP72_HUMAN antibody|HSPA2 antibody|Hspt70 antibody|Hst70 antibody|MGC58299 antibody|MGC7795 antibody|MGC93458 antibody|OTTHUMP00000180664 antibody|Testis-specific heat shock protein-related antibody|XXbac BCX40G17.3 001 antibody
-
Uniprot ID
P54652
-
Entrez GeneID
3306
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
