AMHR2 Antibody

• Catalog number
  R32469
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  AMHR2
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.5-1ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This AMHR2 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q16671
• Purity
  Antigen affinity
• Description
  AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Immunogen
  Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.
• Storage
  Prior to reconstitution, store at 4oC. After reconstitution, the AMHR2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  AMHR2  
• Gene symbol
  AMHR2
• Short name
  Anti- AMHR2
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to AMHR2
• Alternative technique
  antibodies
• Alternative to gene target
  anti-Mullerian hormone receptor, type II, AMHR and MISR2 and MISRII and MRII, AMHR2 and IDBG-36672 and ENSG00000135409 and 269, transforming growth factor beta receptor activity, Plasma membranes, Amhr2 and IDBG-188637 and ENSMUSG00000023047 and 110542, AMHR2 and IDBG-631327 and ENSBTAG00000018524 and

Gene info

• Identity
  HGNC:465
• Gene
  AMHR2
• Long gene name
  anti-Mullerian hormone receptor type 2
• Synonyms gene name
  • anti-Mullerian hormone receptor type II
• Synonyms
  • MISR2
  • MISRII
• Synonyms name
  • Muellerian inhibiting substance type II receptor
• GenBank acession
  • AF172932
• Locus
  12q13.13
• Discovery year
  1997-07-22
• Entrez gene record
  269
• Pubmed identfication
  • 7493017
• RefSeq identity
  • NM_020547
• Classification
  • Type 2 receptor serine/threonine kinases
• VEGA ID
  OTTHUMG00000170048

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products